PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_010931110.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Arecales; Arecaceae; Arecoideae; Cocoseae; Elaeidinae; Elaeis
Family NAC
Protein Properties Length: 240aa    MW: 27066.8 Da    PI: 5.4442
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_010931110.1genomeOGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM1448.2e-4541341127
             NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp.k...kvka.eekewyfFskrdkkyatgkrknratksgyWkatgkdk 90 
                     lppGfrF Pt+eel+++yL++k+e+++ ++e+vi+ vd+y+++P +Lp +   + +  + ++w+fF++r++++a+g ++ r+t sgyWkatg+  
  XP_010931110.1   4 LPPGFRFYPTEEELLNFYLRNKIENTRQDMERVIPAVDVYSYDPVQLPpMsgeA-SIqDPEQWFFFCPRQEREAQGGKPARTTPSGYWKATGSPS 97 
                     79****************************99***************9644532.2224569********************************* PP

             NAM  91 evlskkgelvglkktLvfykgrapkgektdWvmheyr 127
                      v+s++++ +g+kkt+vfy+grap g+kt+W m+ey+
  XP_010931110.1  98 YVFSSRNQRIGVKKTMVFYTGRAPYGTKTKWKMNEYK 134
                     ************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.7E-482162IPR003441NAC domain
PROSITE profilePS5100548.5484162IPR003441NAC domain
PfamPF023656.9E-255134IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 240 aa     Download sequence    Send to blast
MSDLPPGFRF YPTEEELLNF YLRNKIENTR QDMERVIPAV DVYSYDPVQL PPMSGEASIQ  60
DPEQWFFFCP RQEREAQGGK PARTTPSGYW KATGSPSYVF SSRNQRIGVK KTMVFYTGRA  120
PYGTKTKWKM NEYKAFEEAS SSTSSTPPRL RNEFSVCRVY IKSGTLRSFD RRPSAAVAMN  180
TDQSQRNPEA SSSSANPHVQ ADGTSSQGSS SSGDDGSQPL AADGTFDWNE YINSEPFFWE
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4dul_B9e-37416217165NAC domain-containing protein 19
4dul_A9e-37416217165NAC domain-containing protein 19
1ut7_B9e-37416217165NO APICAL MERISTEM PROTEIN
1ut7_A9e-37416217165NO APICAL MERISTEM PROTEIN
1ut4_B9e-37416217165NO APICAL MERISTEM PROTEIN
1ut4_A9e-37416217165NO APICAL MERISTEM PROTEIN
3swp_D1e-36416220168NAC domain-containing protein 19
3swp_C1e-36416220168NAC domain-containing protein 19
3swp_B1e-36416220168NAC domain-containing protein 19
3swp_A1e-36416220168NAC domain-containing protein 19
3swm_D1e-36416220168NAC domain-containing protein 19
3swm_C1e-36416220168NAC domain-containing protein 19
3swm_B1e-36416220168NAC domain-containing protein 19
3swm_A1e-36416220168NAC domain-containing protein 19
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010931110.11e-179PREDICTED: NAC domain-containing protein 90-like
SwissprotQ9FMR39e-75NAC90_ARATH; NAC domain-containing protein 90
TrEMBLR4N7M36e-90R4N7M3_JATCU; NAC transcription factor 037
STRINGGSMUA_Achr6P19400_0018e-88(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP100538140
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G44350.25e-74NAC domain containing protein 61